SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018179 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018179
Domain Number 1 Region: 4049-4185
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-35
Family Synaptotagmin-like (S variant) 0.000000797
Further Details:      
 
Domain Number 2 Region: 4426-4556
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.97e-21
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 3 Region: 3848-3945
Classification Level Classification E-value
Superfamily PDZ domain-like 2.02e-19
Family PDZ domain 0.00000629
Further Details:      
 
Domain Number 4 Region: 409-478
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000617
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018179   Gene: ENSMPUG00000018297   Transcript: ENSMPUT00000018449
Sequence length 4560
Comment pep:novel scaffold:MusPutFur1.0:GL896901.1:26824432:27199554:-1 gene:ENSMPUG00000018297 transcript:ENSMPUT00000018449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRALGGDLAPVPLSPQPKPKTAPVTPPSAVSKPSPQPQQTSPKKDTVPKQDLSKAPEAK
KPPPLVKQPTIHGSPPVAAKQPPVAESSSKPTPPKEPSVPSEQAKVPMAEDKPKQPKTVK
PATDVSSAPTAAKPDTPSSKVQLEDQQITAPPPKTDAAKPSQSFPPTGEKVTPIDSKVIP
RPASDSKILSHPGPSSETKGQKQVDSVQKREEPKKAQTKMSPKPDAKPMPKGSPPAPGLR
PTTGQTAPPSQQPPKPQEQSRRFSLNLGSITDAPRSQPTTPQETVTGKLFGFGASIFSQA
SNLISTAGQPGSQSQSGPGAPTKQGPPPPQPPPQGPPKATGQGSPAPAKVIPVKKETKAP
VAEKLEPKAEQVPTVKRAETEKKPPLVKDSKPSAAEPQTPVLTPKVEKTPKPESTCPLCK
TELNVGSKEPPNFNTCTECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAISGQLGDMG
KMPSTPSGPKASPTPVPPEQPSQKTTMPPQAKMKKKEQEVKTEAEQILPEKVKEIPSVEK
ILPKVTTDHKQESQLEKDKTSAPQEEKPPSEDKKSLPEEKKPPPEEKKPTSEEKKPAPED
KKLPPVTKPSALEEEQKQDLFKTQVPTTEEKPEGIVTPQVVQETPPQTKMEDKPCGPPPS
LPKEDDEATQTMKEQPQAAGTAKPDRVEPGKEKTEKEDDKSDTSSSQQPKSPQGLSDTGY
SSDGISSSLGEIPSLIPSDEKDLLKGLKKDSFSQESSPSSPSDLAKLESTVLSILEAQAS
TLVEEKTEKKTQPPEVTCELPKDQPKTQSLSETLETTVAEEELTKSQEEKDMLKKDSQQD
GPSRKDREEKSEFVDDTATRRQSYDSVEDSSESENSPLPQRKRRTSVGSSSSDEYKQEDS
QGSGEEEDFIRKQIIEMSADEDASGSEDDEFIRSQLKEISSSLESQKKEETKGKGKATPG
KHRRLTRKSSTSFDDDAGRRHSWHDEDDETFDESPELKYRETKSQESEELVIAGGGGLRR
FKTIELNSTIADKYSAESSQKKTTLYFDEEPELEMESLTDSPEDRSRGEGSSSLHASSFT
PGTSPTSVSSLDEDSDSSPSHKKGESKQQRKARHRSHGPLLPTIEDSSEEEELREEEELL
KEQEKQRELEQQQRKTSSKKSKKDKDELRAQRRRERPKTPPSNLSPIEDASPTEELRQAA
EMEELHRSSCSEYSPSIESDPEGFEISPEKIIEVQKVYKLPTAVSLFSPTDEQSIMQKEG
GQKALKSAEEMYEEMMHKTHKYKAFPGATERDEIFEKEPLYGGMLIEDYIYESLVEDTYN
GSVDGSLLTRQEDENGFMQQRGKDQKTRIPEQIYEDPMQKITDLQKEFYQLESLHSVVPQ
EDIVSSSFIIPESHEIVDLGSMVTSTSEEKKLLDADAAYEELMKRQQMQLTPGSSPTQPP
ITDDMTESTMDFDRVPDASLTSSVPSGASLTDSTSSATLSIPDVKITQHFSTEEIEDEYV
TDYTREIQEIIAHESLILTYSEPSESATSVPPSDTPSLTSSVSSVCTTDSSSPITTLDSI
TTVYTEPVDIVTKLEDSEISSSTYFPGSIIDYPEEISVSLDRTAVPDGRTSADHVVISLS
DMEPPIIESVGTVPEGLIADTVSTDSSTSEKDPGKKDKRDTGNGIILEVLEAYRDKREKS
EVELTKMGLSETVFDHPPSSAGALKEQVLATCFLSGQVFDQAKPASPLPSGSPSVTSLPK
KTHPFFRSSSLDASAQPPPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPPVHPKKKLTVT
APVTLTPTATPLVDAVTTVEATALPRSSGLPVTKICTTAPPPVPPKPSSIPSGLVFTHRP
EPSKPPIAPKPAVPQPPVTTQKSADTHPKPTGLSLTSNMTLNLVTSADYKLPSPTSPLSP
HSNKSSPRYSKSLMETYVVITLPSEPGTPTDSSASQAITSWPLGSPPKDLISIEPVFSVV
PPLTTAGMPSTSEQSLYLSGTLETFSALPVTALSSFQAAPTSGTQFFTTEVSKAEVSAAR
SAVPSVGLSSVTISVPPEPLALDNLHLEKRQHKENGKVQLVGDAIDLRTVPKVEVKATEK
CMDLSASTMDMKRQITASDVYGRQMSAVQPSIINLSATPSVIRPMAVVTETVTVATGAAS
SSYTTGAESLMGTAHATTAPLQLTTSKHAEPPYRIPSGQVFPAVREDAPINLSLGTSAHP
VTSAITKPVTVPPVGVTNGWTDGITSQGVTDGEVVDLSTTKSHRTVVTMDESTSGAVTKI
IEDDEKPVDLTAGRRAVCCDMVYKLPFGRSCTAQQPPTTLPEDRFGYRDDHYQYDRSGPY
GYRGIGGMKPSMSDTNLAEAGHFFYKSKNAFDYSGGTDAAVDLTSGRITTGEVMDYSSKT
TGPYPETRQVISEVGISTPQYSTARMTPPPGSQYGVGSVLRSSNGVVYSSVATPIPSTFA
ITTQPGSIFSTTVRDLSGVHTADTVTPLSALHQSQPMPRSYFLTTGASETDIAATGIDIN
ASLQTLTMETLAAETIDAVPTLTTASEVFSEVVGDENAILIVPEEDKQQQQLDLERELLE
LEKIKQQRFAEELEWERQEIQRFREQEKIMVQKKLEELQSMKQHLLYQQEEERQAQFMMR
QETLAQQQLQLEQIQQLQQQLHQQLEEQKIRQIYQYNYDPSGTASPQTTTEQAVLEGQYA
APEGSPFWATEDATTTASAVVAIEIPQSQGWYTVQSDGVTQYIAPPGILGTVSEIPLTDV
VVKDEKPPKKRSSAAKVRGQYDEIGDSDDPRCFKKIVDSGVQTDDEDAADRSYVSRRRRT
KKSVDTSVQTDDEDQDEWDVPTRARRKARAGKYGDSTAEADKTKPLVSKVSSIAVQTVAE
ISVQTEPVGTIRTPSIRARVDAKVEIIKHISAPEKTYKGGSLGCQTEAESDTQSPPYLSA
TSPPKDKKRPTPLEIGYSSHLRADSTLQLAPSPPKSPKVLYSPISPLSPGKALESAFVPY
EKPLPDDISPQKVLHPDMAKVPPASPKTAKMMQRSMSDPKPLSPTADESSRAPFQYTEGY
TTKGSQTMTTSGTQKKVKRTLPNPPPEETSTGTQSTYSTMGTVSRRRICRTNTMARAKIL
QDIDRELDLVERESAKLRKKQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAY
LQGVAEDRDYMSDSEVSSTRPTRIESQHGIERPRTAPQTEFSQFIPPQTQTESQLVPPTS
PYTQYQYSSPALPTQAPTPYTQQSHFQQQTLYHQQVSPYQTQPTFQAVATMSFTPQAQPT
PAPQPSYQLPSQMMVIQQKPRQTTLYLEPKITSNYEVIRNQPLMIAPVSTDNSYAVSHLG
SKYNSLDLRIGLEERSSMASSPISSISADSFYADIDHHTPRNYVLIDDIGEITKGTAALS
TAFSLHEKDLSKTDRLLRSTETRRSQEVTDFLAPLQTSSRLHSYVKAEEDPMEDPYELKL
LKHQIKQEFRRGAESLDHLAGLSHYYHADTGYRHFPKSEKYSISRLTLEKQAAKQLPAAI
LYQKQSKHKKSLIDPKMSKFSPIQESRDLEPDYSSYMTSSTSSIGGISSRARLLQDDITF
GLRKNITDQQKFMGSSLGTGLGTLGNTLRSALQDEADKPYSSGSRSRPSSRPSSVYGLDL
SIKRDSSSSSLRLKAQEAEALDVSFGHASPSGRTKPTSLPISQSRGRIPIVAQNSEEESP
LSPVGQPMGMARAAAGPLPPISADTRDQFGSSHSLPEVQQHMREESRTRGYDRDIAFIMD
DFQHAMSDSEAYHLRREETDWFDKPRESRLENGHGLDRKLPERLVHSRPVSQHQEQIMQM
NGKTVHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHNGEIGAYIAKILPGGSA
EQTGKLIEGMQVLEWNGIPLTSKTYEEVQSIISQQSGEAEICVRLDLNMLSDSENPQHLE
LHEPPKAVDKAKSPGVDPKQLAAELQKVSLQQSPLVLSSVVEKGSHVHSGPTSAGSSSVP
SPGQPGSPSVSKKKHSSSKPTDATKVVSHPITGEIQLQINYDLGNLIIHILQARNLVPRD
NNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLK
KKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYSLKEQTESIDHGKSHSSQSS
QQSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTS
VTQSHLEDAGAAIAAAEAAVQQLRLQPTAHKSGQTNHARKQHRHSIAGVLPIQRTQSDNL
PPPANGNQDQSQLALRKVVSDGPIKPEGAKPTNHRPAESSVSTGSSGSSFGSGYSVDSEG
SSSTAGETNLFPIPRIGKMGQNGQEPVKQPGVGVGLADTEVKTQVMGEIKIALKKEMKTD
GEQLIVEILQCRNITYKFKSPDHLPDLYVKIYVMNISTQKKVIKKKTRVCRHDREPSFNE
TFRFSLSPAGHSLQILLFSNGGKFMKKTLIGEACIWLDKVDLRKRIVNWHKLLVSPTQTH
Download sequence
Identical sequences M3Z3L7
ENSMPUP00000018179 ENSMPUP00000018179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]