SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018251 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018251
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily EF-hand 1.2e-23
Family S100 proteins 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018251   Gene: ENSMPUG00000018369   Transcript: ENSMPUT00000018521
Sequence length 97
Comment pep:novel scaffold:MusPutFur1.0:GL897036.1:5629234:5629527:1 gene:ENSMPUG00000018369 transcript:ENSMPUT00000018521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQMEHAMETMMFTFHKFAGEKGYLTKEDLRVLMEKEFPGFLENQKDPLVVDKIMKDLD
QCQDGKVGFQSFFLLIAGLTIACNDYFVVHMKQKGKK
Download sequence
Identical sequences M3Z3T9
ENSMPUP00000018251 ENSMPUP00000018251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]