SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018538 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018538
Domain Number 1 Region: 112-177
Classification Level Classification E-value
Superfamily Chromo domain-like 6.19e-25
Family Chromo domain 0.000033
Further Details:      
 
Domain Number 2 Region: 20-79
Classification Level Classification E-value
Superfamily Chromo domain-like 1.14e-21
Family Chromo domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018538   Gene: ENSMPUG00000018657   Transcript: ENSMPUT00000018809
Sequence length 183
Comment pep:novel scaffold:MusPutFur1.0:GL897023.1:5906175:5906726:1 gene:ENSMPUG00000018657 transcript:ENSMPUT00000018809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNT
WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG
LDPERIIGATDSSGELMFLMKWKDSDEADLMLAKEANMKYPQIVIAFYEEKLTWHSCPED
EAQ
Download sequence
Identical sequences M3Z4M6
ENSMPUP00000018538 ENSMPUP00000018538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]