SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018694 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018694
Domain Number 1 Region: 112-176
Classification Level Classification E-value
Superfamily Chromo domain-like 9.28e-26
Family Chromo domain 0.0000293
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily Chromo domain-like 4.58e-16
Family Chromo domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018694   Gene: ENSMPUG00000018814   Transcript: ENSMPUT00000018966
Sequence length 177
Comment pep:novel scaffold:MusPutFur1.0:GL896905.1:1571404:1571934:1 gene:ENSMPUG00000018814 transcript:ENSMPUT00000018966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVGKVLDRRVVNGKAESFLKWKGFTDADNT
WEPEENLDGPELIEVFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG
LDPEQIIGATDSSGELMFLMKWKDLDEADLVLAKEANMKCPQIVIAFYEERLTWHSC
Download sequence
Identical sequences M3Z532
ENSMPUP00000018694 ENSMPUP00000018694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]