SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018830 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018830
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-28
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 148-216
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.51e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018830   Gene: ENSMPUG00000018950   Transcript: ENSMPUT00000019102
Sequence length 285
Comment pep:novel scaffold:MusPutFur1.0:GL897008.1:6300726:6301583:-1 gene:ENSMPUG00000018950 transcript:ENSMPUT00000019102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDSLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFND
ILVYGSVVLPKRKYRSQHVIPLEEVTLEPLPETPRAKNRWMIKTARKSFVVSAASATERQ
EWISHIEECVRRQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGF
VVCAECSRERFLLPRLSPKPLRVCSLCYRELAACKRREEEEEEEEEEEPGVGSPGQPSYL
SGAGTGASSGDEEDSDEDKEGSGDSNWSSRVEFYASGVSWSAFHS
Download sequence
Identical sequences M3Z5G8
ENSMPUP00000018830 ENSMPUP00000018830 XP_004765295.1.14098 XP_012918324.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]