SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018924 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018924
Domain Number 1 Region: 49-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000203
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 2 Region: 273-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000174
Family I set domains 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000018924
Domain Number - Region: 172-205
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0536
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018924   Gene: ENSMPUG00000019046   Transcript: ENSMPUT00000019198
Sequence length 413
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:1698555:1699796:-1 gene:ENSMPUG00000019046 transcript:ENSMPUT00000019198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLAHTAVLLWVWGSLQAFEIVEQENIFQRTPCPAFLMFDNAAYLADMSFELPCRCKPEE
VSTVVWYYQKHLGSDHTRVLTDFDGRVLTEESQVHVGSDMLVRFSIRMFSLLVFRAQPED
SGLYFCGTRKGDYFYAYDVDIQSGEDMVATFKDQGQEPFADEHRGNLHIFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPGLSPRFRRTLPDVVSCGSQAVPQKLRAQAREHTPELLVQSC
VVPCEKKEVREGLVAILSYVSKVGSRPWLPQVPIQFHQQRLGQGLIISCPGARPEHAVAW
DKDRQYFYRTQYLRGVNRSMRVFIDHGNHLHIRFTQLSDRGIYYCWRQGVRVAGLRLGVT
ARGHYRASFSDPETRSAVQLTLIGYLVITAVFVTIHLCRCCCYLSRCWPNYSP
Download sequence
Identical sequences M3Z5R2
XP_004772561.1.14098 ENSMPUP00000018924 ENSMPUP00000018924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]