SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019004 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019004
Domain Number 1 Region: 89-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-53
Family SPRY domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000143
Family RING finger domain, C3HC4 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019004   Gene: ENSMPUG00000019127   Transcript: ENSMPUT00000019279
Sequence length 270
Comment pep:novel scaffold:MusPutFur1.0:GL896937.1:6596154:6596966:1 gene:ENSMPUG00000019127 transcript:ENSMPUT00000019279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSLQEEVTCPVCLEIFFCPILLSCDHVFCFHCMQRWMLEHTDLKLTCPMCRGVTESPP
LEEWQIRALSLLIRQHSGLLMKSLHVSQELLRFREVMTLDRSTANPFLVLSDDLRNVWCG
KICHNAVEDPQRFTYLTCVLGTPYFSSGCHYWEVEVGDGKEWTLGICKESVDRKRKGGFS
VEHGFWLISLKAGTICTSSNPEIRIPASPKLSHVGIFLDVELEELKFFDTRENALIYTYS
CLSCFEPLRPFFCPELPREGDRGASLKICS
Download sequence
Identical sequences M3Z5Z2
ENSMPUP00000019004 ENSMPUP00000019004 XP_004753653.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]