SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019088 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000019088
Domain Number - Region: 74-85,116-142
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0879
Family Chromo domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019088   Gene: ENSMPUG00000019212   Transcript: ENSMPUT00000019364
Sequence length 288
Comment pep:known scaffold:MusPutFur1.0:GL897181.1:200868:201734:-1 gene:ENSMPUG00000019212 transcript:ENSMPUT00000019364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRKQGSQTRGQQSAEEDNFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWG
GRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRME
VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVN
EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLA
YTPLDEKSLALLLGYLHDFLKYLAKNAASLFTASDYKVASAEYHRKAL
Download sequence
Identical sequences D2HTN4 G9KB29
ENSMPUP00000019088 ENSAMEP00000019596 ENSAMEP00000019596 XP_002925970.1.58354 XP_002925971.1.58354 XP_004415834.1.74151 XP_004415835.1.74151 XP_004415836.1.74151 XP_004415837.1.74151 XP_004415838.1.74151 XP_004415839.1.74151 XP_004778734.1.14098 XP_006736652.1.47382 XP_006736653.1.47382 XP_006736654.1.47382 XP_006736655.1.47382 XP_006736656.1.47382 XP_006736657.1.47382 XP_008702396.1.72690 XP_008702404.1.72690 XP_012904508.1.14098 XP_021546991.1.83697 XP_021546999.1.83697 ENSMPUP00000019088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]