SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019479 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019479
Domain Number 1 Region: 52-198
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 4.47e-47
Family Retrovirus capsid protein, N-terminal core domain 0.0013
Further Details:      
 
Domain Number 2 Region: 205-282
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.61e-22
Family Retrovirus capsid protein C-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 337-353
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000019479
Domain Number - Region: 292-329
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000142
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019479   Gene: ENSMPUG00000019607   Transcript: ENSMPUT00000019759
Sequence length 353
Comment pep:novel scaffold:MusPutFur1.0:GL897301.1:262845:263906:1 gene:ENSMPUG00000019607 transcript:ENSMPUT00000019759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEELEQKVGQKPEPLQSLPTATPRAPPPYNTCMNRDICGCHAPTTESWTTKWKEAGFT
SAFPVLEDQNYQRYHQPLDFKLVKQLKEAVMQYGPQAAFTISLVESIAGMNLIPEDWGNL
ARAALSGGQYLVWKTAWQEHSQDVAWHNAASGNLQWNLDMLMGMGPYVGRNEQLQYNPAV
YLQIAASATKAWKTLQGCGDLQGQLSKVIQGSNEAYADFVARLMQTAGRIFGDADTAMPL
IKQLAYEQANKWCKEAIRPWKAKDLSTYIKVCRDINDSVIQGQVLASAINQGFQSIQGPQ
CRNNKGGTEGYYKCGAQGHFKQECPGNKGPNQVTKRPGLCPRCGKGAHWANEC
Download sequence
Identical sequences M3Z7B6
ENSMPUP00000019479 ENSMPUP00000019479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]