SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019742 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019742
Domain Number 1 Region: 256-388
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.26e-36
Family Retrovirus capsid protein, N-terminal core domain 0.011
Further Details:      
 
Domain Number 2 Region: 394-471
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.04e-23
Family Retrovirus capsid protein C-terminal domain 0.0016
Further Details:      
 
Domain Number 3 Region: 4-88
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 2.71e-20
Family Mason-Pfizer monkey virus matrix protein 0.00053
Further Details:      
 
Domain Number 4 Region: 532-562
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000105
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Domain Number 5 Region: 492-521
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000031
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019742   Gene: ENSMPUG00000019872   Transcript: ENSMPUT00000020024
Sequence length 607
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:1208908:1210731:1 gene:ENSMPUG00000019872 transcript:ENSMPUT00000020024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVVFMTALQALMKQKGSKVSKKALQQFFCTVSELCPWFPKEGTVSLDAWQKVGQEIKN
QIKIHGPTACPPSTMQVWEDIREVLDPQHSFKLISIASQEPPDRPEVHDLPKVTEDIEDL
MADLPLPSAELIEQTSNSRPPPSHSICNNKKCEPHAAPPRVPPTPPLIKVGGYEIEEDDV
YLDDDKEVIFSSSAPARLRSFSQQDIHGKIPTSRKLRPVLGTTSSGTQTFTVNHTETQTY
GSVPAKPNSQIGYSIMQHENGQRRYADLNFKILKEIKTATAQYGPTAPYTLYLLDSVGQV
ALCPDDWRVIAKACLSGGDYLLWKTEFYERANEMAVYNHRTNIPVSYEMLIGMEAYAEVS
TQIDYPEIAYNQIGQCALTAWKRLPSSGTRTVELSKIRQGPDEHYQDFVARLLKEVGRIV
DDGEARTIIVKHLAFENANSFCQVAIRPRKNKGTLEDYIRLCAEIGSSYIQGITLAAALR
GISPQEMQKRMMQKGNNKKQTCFQCGHVGHFKAQCPQLMDRQVKNGKISKKPPLLCPKCQ
RGYHWANECRSQKDKFGNIIQGNWRRGSLQPQQTIAAMIPQMSALGPVPRTSQASTSYSA
VPPPVQD
Download sequence
Identical sequences M3Z829
ENSMPUP00000019742 ENSMPUP00000019742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]