SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019793 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019793
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.31e-79
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019793   Gene: ENSMPUG00000019924   Transcript: ENSMPUT00000020076
Sequence length 164
Comment pep:novel scaffold:MusPutFur1.0:GL896935.1:5950601:5951095:1 gene:ENSMPUG00000019924 transcript:ENSMPUT00000020076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFSDKVPKTAENFHALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI
Download sequence
Identical sequences M3Z880
ENSMPUP00000019793 ENSMPUP00000019793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]