SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019919 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019919
Domain Number 1 Region: 33-310
Classification Level Classification E-value
Superfamily L domain-like 8.84e-53
Family Ngr ectodomain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 408-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000745
Family EGF-type module 0.019
Further Details:      
 
Domain Number 3 Region: 460-539
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000238
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019919   Gene: ENSMPUG00000020051   Transcript: ENSMPUT00000020203
Sequence length 673
Comment pep:novel scaffold:MusPutFur1.0:GL896925.1:12143680:12145701:-1 gene:ENSMPUG00000020051 transcript:ENSMPUT00000020203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSRIPLRLLLPLLLLAPEPGVWGCPSGCQCNQPQTVFCTARQGTTVPRDVPPDTAGLYV
FENGITTLDAGSFASLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLREITNET
FHGLRRLERLYLGKNRIRHIQPGAFDTLDGLLELKLQDNDLRALPPLHLPRLLLLDLSHN
SLPALEPGTLDTANVEALRLAGLGLRRLDEGLFSRLRNLHDLDVSDNQLERVPPAIRGLR
GLTRLRLAGNTRIAQLRPEGLAGLVALQELDLSNLSLQALPHELSGLLPRLRLLAAARNP
FNCVCPLSWFGPWLRDSHVALASPEETRCHFPPKNAGRLLLDLEYADFGCPATTTTATAP
TTKPEVWGPTFSPSSPAPTWLSPTELVTEAPSLPPAAPPTVRPPSRPQDCPASICLNGGT
CHLGVQGHLECLCPELFVGLYCESRVRQGLPASPAPATLQPPQPPALGIEPASPTSLRVG
LRRYLQGSALQLRSLRLTYRNLSGPDKRPVTLRLPASLAEYTVTQLRPNATYSICVRPLG
VGRVPEGEEACGEARTPPASRSNHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCV
RRGRAAAAAHGKAQLGPGTGPLELEGVKAPLEPGPKATEVGGEAPPSGPECEVPLMGYAG
PSPQGPLPAKPYI
Download sequence
Identical sequences M3Z8K5
ENSMPUP00000019919 ENSMPUP00000019919 XP_004750575.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]