SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019973 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019973
Domain Number 1 Region: 129-203
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.62e-30
Family AN1-like Zinc finger 0.0000737
Further Details:      
 
Domain Number 2 Region: 13-62
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000013
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019973   Gene: ENSMPUG00000020107   Transcript: ENSMPUT00000020259
Sequence length 208
Comment pep:novel scaffold:MusPutFur1.0:GL896899.1:455875:456501:1 gene:ENSMPUG00000020107 transcript:ENSMPUT00000020259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVSSLSE
SLPVQCVDGGGPDVQCPLDSACASVQPSPVSNQSLLSESVASSQVDSTSVDKAVPDPEDL
QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHN
CSYNYKADAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences M3Z8Q9
ENSMPUP00000019973 ENSMPUP00000019973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]