SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000151 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000151
Domain Number 1 Region: 1263-1377
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-34
Family Pleckstrin-homology domain (PH domain) 0.00099
Further Details:      
 
Domain Number 2 Region: 1066-1245
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.27e-18
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000151   Gene: ENSMPUG00000000154   Transcript: ENSMPUT00000000155
Sequence length 1518
Comment pep:known scaffold:MusPutFur1.0:GL896964.1:61157:79494:1 gene:ENSMPUG00000000154 transcript:ENSMPUT00000000155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLA
KVQQEACAQYSGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLA
LKCLAPGGGRVQELPVPNEACAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAE
LICPRFVHKGGLMVGHQPSTLPPELPSGPPGLPSPPLPEEALGTRSPGDGHNAPAEGPEG
EYVELLEVTLPVRGSPTDAEGPSGLSRTRTVPTRKGAGGKGRHRRHRAWMHQKGLGPRDQ
DGARPPGEGSSTRASPGSPPGAEALPEATALEVSESPAETLGEASEPCPLRLGEAGGGAG
QGAEGPPGTPRRTGKGNRRKKRAAGRGALSRGGDSAPLSPEVKEEASHLEVLVTLPPPNE
HDPPGYSPVEEEHKGSGKPESELKEELKPAEKKEPQPSEGCGPTEETAREKDPEGSSLAG
VAGPAGPEGLLPDPPAPPPEMVQEGEGDSAPEEAAPVSISDDLDIAWDLMASGFLVLTGG
VDQSGRALLTITPPCPPEEPPPSRDMLSTALHYLHSLLRPDLQILGLSILLDLRKAPPLP
PALISVLSQLQDLGDPPLIQRLLALTQDDPVAELCGLQGAELLSESDLKRVAKPEELPWD
LGGHREPSPSYWVETHQDVARLCCLCQGVLCSVRQAIEELEGAAEPEGEESVGMLEPLQK
VLADPRLTELQRDGGAILMRLRSSHSSKLEGPGPAALYQEVDEAIHQLVRLSNLHAQQQE
RRQRLHRLEQVLQWLSGPGEEQLASFAVPGDSLSALQETELQFRAFNTEVQERLAQAREA
LALEEDTASQKVLDVFEQRLEQAESGLHRALRLQRFFQQAHEWVNEGSARLAGAGPGREA
VLAALALRRAPEPSAGTFQEMRALALDLGSPAALREWGRCRARCQELERRIQQQLGEEAS
PRGHRRRRADSTSSGGAPRGSHSPSPSLSSLMLPSSPGPRTAPSHCSLAPCGEDCEEEGP
DLAPEAEGRPPRTVLIRGLEVTSTEVVDRTCSPREHVLLGRAGGPDGPWGVGTPRMERKR
SISAQQRLVSELIACEQEYVATLSEPVPAPGPELTPELRGTWAAALSTRERLRSFHRTHF
LRELQGCATHPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALGPPSKGSTESGPHLP
QALQQPLEQLARYGRLLEELLREAGPELSSERQALGAAVQLLREQETRGRDLLAVEAVRG
CETDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSETFVYKQAFKT
ADMGLTENIGDSGLCFELWFRRRRAREAYTLQAASPEIKLKWTSSIAQLLWRQAAHNKEL
RVQQMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPGA
CSLPARVEEEAWDLDVKQISLAPETLDSSGDVSPGPRNSPSLQPPHPGSSTPTLASGGIL
GLSRQSHARALSDPTTPL
Download sequence
Identical sequences M3XM51
ENSMPUP00000000151 ENSMPUP00000000151 XP_004758621.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]