SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000416 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000416
Domain Number 1 Region: 124-422
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.44e-89
Family Nuclear receptor ligand-binding domain 0.00000000154
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-28
Family Nuclear receptor 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000416   Gene: ENSMPUG00000000419   Transcript: ENSMPUT00000000424
Sequence length 427
Comment pep:novel scaffold:MusPutFur1.0:GL897011.1:6434734:6491648:-1 gene:ENSMPUG00000000419 transcript:ENSMPUT00000000424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMTASAPLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALRDSL
RPKLSEEQQQIIAILLDAHHKTYDPTYADFSQFRPPVRGEGGGGSHSSRPSSVQTPSLSG
DSSSSCSDNYTASLDVMEPTSFSNLGLREEDSDDSSLTLDLSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFIMDDMSWTCGSPDYKYRISDV
AKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALVEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
Download sequence
Identical sequences M3XMW6
XP_004765677.1.14098 ENSMPUP00000000416 ENSMPUP00000000416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]