SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000515 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000515
Domain Number 1 Region: 287-530
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.3e-55
Family Crotonase-like 0.00000000893
Further Details:      
 
Domain Number 2 Region: 6-62
Classification Level Classification E-value
Superfamily Chromo domain-like 3.07e-18
Family Chromo domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000515   Gene: ENSMPUG00000000521   Transcript: ENSMPUT00000000527
Sequence length 543
Comment pep:novel scaffold:MusPutFur1.0:GL896938.1:3654121:3732571:1 gene:ENSMPUG00000000521 transcript:ENSMPUT00000000527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSVSKQVERIVDKRKNKKGKIEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTE
KQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKSLVIGKDHESKNSPLFGASQKFRK
NTAPSLSNRKNMDLAKSGIKILVPKSPIKSRTAVDGFQNESPEKLDPVEQGQEDTVAPEV
AAEKPVGALLGPGAERARMGSRPRIHPLVPQVSGPVTAAMATGLAVNGKGSSPFMDALTA
NGTTSIQTSVTGVTAGKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHI
LLSTKSSENNSLNPEVMKEVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDD
RKRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPY
TTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMV
RIKELASCNPVVLEESKALVRCNMKLELEQANERECEVLKKIWGSAQGMDSMLKYLQRKI
DEF
Download sequence
Identical sequences M3XN65
ENSMPUP00000000515 ENSMPUP00000000515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]