SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000642 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000642
Domain Number 1 Region: 938-1155
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-60
Family DBL homology domain (DH-domain) 0.0000000551
Further Details:      
 
Domain Number 2 Region: 1141-1294
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-45
Family Pleckstrin-homology domain (PH domain) 0.00000175
Further Details:      
 
Domain Number 3 Region: 839-965
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-24
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000642   Gene: ENSMPUG00000000648   Transcript: ENSMPUT00000000654
Sequence length 1362
Comment pep:known scaffold:MusPutFur1.0:GL897094.1:3090071:3333943:-1 gene:ENSMPUG00000000648 transcript:ENSMPUT00000000654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGRILAALYFSPLLFCKISRFVNPTTPRETQELTWPYQVKVQTGDFHLSVLFQLQAVAT
SEEPDVHSRCESQAGSSLGDEGLHPGPVDTDVQVGLNPTALWPRTHSPENMTTAQNGHGQ
LAAIPCSVSDPKDPKMVTYPACQNGGCSSSYCGEAEAQEARLSPAKLMRLFSVSRKRTGT
NPERPRSMVLMGNSSTWNALASFRKMGSFKKLKSSVLQGIQNREASDVPREDPPERDPGK
PISNGAAVGMQTSRCPNSGPASDAPKAGPGGVSDCSDPEEADDAFQRSTHRSRSIRRAYG
LGRISLLDGDKHPGSQNHVRPLAPGPQEPTVCEILVKDSENNSIIYRKSKSTDNLNFLKK
SSFKRKSTSNLMDLKGAQEKPAPRRTLSSSSADSEKFGGSERRTKRWKSPLRAKDFDRVL
RFVSSATDAAWRKESPRSGAPSPGEASQRLQVHSRLHDAYSRRVSTSAEREWRRCAGAHA
GSGCGSPGAPSPRVDVDTAVFPLEAPGSWAAESARPCAASASSSPVAQDSEERRAGGPFT
FEAEQPLIPPRPTTPKPPSPHSPGAGSAACPNSLSALSLSSVDSEERAEGPVTSRDSVQA
AYDKGREDSAGSHPQLSPHLASGAEERREEVVTEESWRRDSSRDEERTESQRITRRKWGS
GRRARPRPLSDYGQLANRSLSIPEDSVAVDPQKEDTVEGDHLPNMASTDTTDQSDTADQS
AAVGCPKGSWRRRPISVIGGVSFYGNSPTEEIESLLTQPAARPPVPAHRVLPYKAVSARF
RPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTESAALVDDNGSEEDYSYEDLCQANPRY
LQPGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWWWGRNE
DKEAWFPASFVRLRVNQEELSENSSSTQGEEHEEDAGKNHHKHSESKHQMRTNVIQEIMN
TERVYIKHLKDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFLKDLEKQYNKE
EPHLSEIGSCFLQHQEGFAIYSEYCNNHPGACAELSNLMKQGRYRHFFEACRLLQQMIDI
AIDGFLLTPVQKICKYPLQLAELLKYTTPEHSDYNNIKAAYEAMKNVACLINERKRRLES
IDKIARWQVSIVGWEGLDILDRSSELIHSGELTKVTRHGKSQQRTFFLFDHQLVSCKKDL
LRRDVLYYRGRTDMDDVELVDLEDGRDKDWNLSVKNAFKLVSKTTDEVHLFCARKQEDKV
RWLQACEDERRRVREDREMGMEISENQKKLAMLNAQKAGHGKSKGYSGCPVAPPHQNLHP
LHQRHVTVPTSVPQQQVFALAEPKRKPSLFWHTFNKLTPFKK
Download sequence
Identical sequences M3XNJ2
ENSMPUP00000000642 ENSMPUP00000000642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]