SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000660 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000660
Domain Number 1 Region: 426-537
Classification Level Classification E-value
Superfamily SH2 domain 8.08e-33
Family SH2 domain 0.00000511
Further Details:      
 
Domain Number 2 Region: 102-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-31
Family Ras-binding domain, RBD 0.00031
Further Details:      
 
Domain Number 3 Region: 229-343
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000329
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000660   Gene: ENSMPUG00000000662   Transcript: ENSMPUT00000000672
Sequence length 540
Comment pep:known scaffold:MusPutFur1.0:GL896909.1:17683920:17799752:-1 gene:ENSMPUG00000000662 transcript:ENSMPUT00000000672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSLQDGQSAADRAAAQDSPLAAQVCGAAQGRGDARDLAPAPWLHTRALLPPPDGTRGC
AADRRKKKDLDVLEMPSIPNPFPELCCSPFTSVLSAGLFPKANSRKKQVIKVYSEDETSR
ALEVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGLERTMEDHELVIEVLSNWGME
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFLLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGA
PTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGC
GSQSVSPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLATHGSP
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMS
HGQKIKHFQIIPVEDDGDLFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL
Download sequence
Identical sequences M3XNL0
XP_004744029.1.14098 ENSMPUP00000000660 ENSMPUP00000000660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]