SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000884 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000884
Domain Number 1 Region: 62-327
Classification Level Classification E-value
Superfamily L domain-like 1.7e-54
Family Internalin LRR domain 0.034
Further Details:      
 
Domain Number 2 Region: 307-459
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 3.92e-30
Family Outer arm dynein light chain 1 0.004
Further Details:      
 
Domain Number 3 Region: 1435-1524
Classification Level Classification E-value
Superfamily PDZ domain-like 8.92e-23
Family PDZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000884   Gene: ENSMPUG00000000888   Transcript: ENSMPUT00000000900
Sequence length 1528
Comment pep:novel scaffold:MusPutFur1.0:GL896990.1:4861457:5416003:1 gene:ENSMPUG00000000888 transcript:ENSMPUT00000000900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMENLIRGRNPPQYQRSPCKEVRAALRKRPEEELQCLEMTTKRKIIGRLVPCRCFRGEEE
IISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEELPKQLFNCQALRKLSIPDNDLS
NLPTTIASLVNLKELDISKNGVQEFPENIKCCKCLTIIEASVNPISKLPDGFTQLLNLTQ
LYLNDAFLEFLPANFGRLVKLRILELRENHLKTLPKSMHKLAQLERLDLGNNEFSELPEV
LDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSS
NMLQQLPDSIGLLKKLTTLKVDDNQLTILPNTIGNLSLLEEFDCSCNELESLPSTIGYLH
SLRTLAVDENFLPELPREIGSCKNVTVMSLRSNKLEFLPEEIGQMQKLRVLNLSDNRLKN
LPFSFTKLKELAALWLSDNQSKALIPLQTEAHPETKQRVLTNYMFPQQPRGDEDFQSDSD
SFNPTLWEEQRQQRMTVAFEFEEKKEDDENAGKVKDHPCQAPWERGQRGITLQPARLSGD
CCTPWARCDQQIQDMPVPQNDPQLAWGCISGLQQERSMCTPLPVAAQSTTLPSLSGRQVE
INLKRYPTPYPEDLKNMVKSVQNLVGKPSHGVRVENSNPTANTEQTVKEKYEHKWPVAPK
EITVEDSFVHPANEMRIGELHPSLAETPLYPPKLVLLGKDKKESTDESEVDKTHCLNNSV
SSGTYSDYSPSQASSGSSNTRVKVGSLQTTAKDAVHNSLWGNRIAQSFPQPLDSKPLLTQ
REAVPPGNLPQRPDRLPMSDAFTDNWTDGSHYDNTGFVAEETTGENANNNPLLSSKSRST
SSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSNPWQNWTRTPSPFEDRTAFPSKL
ETTPTTSPLPERKEHIKESAEIPSPFSPGVPWEYHDSNPNRSLSNVFSQIHCRPESSKGV
ISISKSTERLSPLMKDIKSNKFKKSQSIDEIDIGTYKVYNIPLENYATGSDHLGSHERPD
KMLGPEHGMSSMSRSQSVPMLDDEMLTYGSSKGPQQQKASMTKKVYQFDQSFNPQGAVEV
KAEKRIPPPFQHNSEYVQQPGKNIAKDLVSPRAYRGYPPMEQMFSFSQPSVNEDAVVNAQ
FASQGARAGFLRRADSLASSTEMAMFRRVSEPHELPPSDRYGRPPYRGGLDRQSSVSVTE
SQFLKRNGRYEDEHPSYQEVKAQAGSFPVKNLTQRRPLSARSYSTESYGASQTRPVSARP
TMAALLEKIPSDYNLGNYGDKPSDNSDIKTRPTPVKGEESCGKMPADWRQQLLRHIEARR
LDRTPSQQSNILDNGQEDVSPSGQWNPYPLGRRDVPPDTITKKAGSHIQTLMGSQSLQHR
SREQQPYEGNINKVTIQQFQSPLPIQIPSSQATRGPQPGRCLIQTKGQRSMDGYPEQFCV
RIEKNPGLGFSISGGISGQGNPFKPSDKGIFVTRVQPDGPASNLLQPGDKILQANGHSFV
HMEHEKAVLLLKSFQNTVDLVIQRELTV
Download sequence
Identical sequences M3XP84
ENSMPUP00000000884 XP_012917096.1.14098 ENSMPUP00000000884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]