SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000959 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000959
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.88e-68
Family FCH domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000959   Gene: ENSMPUG00000000965   Transcript: ENSMPUT00000000978
Sequence length 334
Comment pep:known scaffold:MusPutFur1.0:GL896931.1:3262742:3328374:1 gene:ENSMPUG00000000965 transcript:ENSMPUT00000000978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGALFKANFWSTDILSTVGYDCLIQHLNNGRKNCKEFEDFLKERASIEEKYGKDLLNLS
RKKPCGQSEINTLKRALEVFKQQVDNVAQCHIQLAQTLREEARKMEEFREKQKLQRKKTE
ILMDAVHKQKSLQFKKTMDAKKTYEQKCRDKDEAEQAVHRSANLVNPKQQEKLFVKLATS
KTAVEDSDKTYMMHISTLDKIREDWQSEHIKACEMFEAQECERINFFRNALWLHVNQLSQ
QCVTSDDMYEEVRKSLEACSIEKDIAFFVNHRKTGQTPPAPIMYENFYCPQKNTASQGKA
PGPNLARRGPLPVPRSTPDDQDYSLVNDYSLIYQ
Download sequence
Identical sequences M3XPF9
ENSMPUP00000000959 ENSMPUP00000000959 XP_004752280.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]