SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001361 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001361
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000000128
Family Pyk2-associated protein beta ARF-GAP domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001361   Gene: ENSMPUG00000001373   Transcript: ENSMPUT00000001389
Sequence length 533
Comment pep:novel scaffold:MusPutFur1.0:GL897132.1:1909442:1965570:1 gene:ENSMPUG00000001373 transcript:ENSMPUT00000001389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVP
PEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPALHLNKGTPSQSPVVGRSQV
QQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQS
SGSSNFGGFPTASHSPFQPQTTAFRMLSSSCSFGEFTSAFPLQASNSGSAGSVNANFAHF
DNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTTDKYAALANLDNIFSAGQGGDQ
GSGFGTTGKAPVGSVVSVPTQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVF
GTVPVGASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATGLSGAM
HSQVFPHAHFAATFGTASMSMPAGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQ
QANGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Download sequence
Identical sequences M3XQL1
ENSMPUP00000001361 ENSMPUP00000001361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]