SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001630 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001630
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 1.54e-39
Family Rap30/74 interaction domains 0.00000056
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.8e-24
Family DNA-binding domain from rap30 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001630   Gene: ENSMPUG00000001647   Transcript: ENSMPUT00000001664
Sequence length 249
Comment pep:novel scaffold:MusPutFur1.0:GL896968.1:3164957:3320503:-1 gene:ENSMPUG00000001647 transcript:ENSMPUT00000001664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKSQGRTEVSFTLNE
DLANIHDIGGKPASVSTPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGVQNVKGTHKNTWELKPEYR
HYQGEEKSD
Download sequence
Identical sequences M3XRD0
ENSMPUP00000001630 ENSMPUP00000001630 XP_004759292.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]