SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001679 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001679
Domain Number 1 Region: 158-278,342-410
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000492
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 2 Region: 290-451
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000166
Family Reprolysin-like 0.05
Further Details:      
 
Domain Number 3 Region: 1208-1275
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000104
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 4 Region: 1139-1211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000104
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 5 Region: 1077-1147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000103
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 6 Region: 1008-1081
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000032
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 7 Region: 1-66
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000384
Family Clostridium neurotoxins, the second last domain 0.072
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001679
Domain Number - Region: 465-500,679-732
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000135
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001679   Gene: ENSMPUG00000001696   Transcript: ENSMPUT00000001714
Sequence length 1420
Comment pep:novel scaffold:MusPutFur1.0:GL897086.1:1402491:1706710:1 gene:ENSMPUG00000001696 transcript:ENSMPUT00000001714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLYMNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNHNYRGYIERFSLWKVARTQRE
ILLDMETHGLHAPLPQLLLQENWDNVKHTWSPMKDGNIPQVELSGAHGFLLDTSLEPPLC
GQTLCDNTEVIASYNQLPRFRRPKVVRYRVVNLHDDNHENPTVSRQQIDFQHRQLAEAFR
HYNISWDLEVLEVSNSSLRHRLVLANCDISKIGDESCDLECNHTLTGHDGGDCRHLRHPA
FVKKQHNGVCDMDCNYERFNFDGGECCDPEITDVTKTCFDPDSPHRAYLDVNELKNILRL
DGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTHTMIHEIGHS
LGLYHIFRGISEIQSCSDPCMETEPSFETGDLCSDTNPAPKHKFCGDPGPGNDTCGFHSF
FNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQSWQPSRKPAPVALAPQIVGHTSD
SVTLEWFPPIDGHFFERELGSACDLCLEGRILVQYAINASSPMPCGPSGHWSPREAEGHP
DVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFRYPLVPESLTVWVTFVSTDW
DSSGAVNDIKLLTVSGKNISLGPQNVFCDVPLTIKLRDVGEEVYGIQIYTLDEHLEIDAA
MLTSIADSPLCLECKPLQYKVVRDPPLHVDVASLLYLNRRFTDTDLSLGSVYQYWVITIS
GSEESEPSPAAIYIHGSGYCGDGIIQKSQGEECDDMNKLSGDGCSLFCRREDSFNCIDEP
SRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVIIGQPAA
SQVCRTKVIDLSEGISQHAWYPCTFSYPYSQMAQTTFWLRAYFSQPMVAAAVIVHLVTDG
TYYGDQKQETISVQLFDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSRPFYHSRAVRVSFS
SPLVAISGVALRSFDNFDPVTLSSCQRGETYSSAEQSCVHFACEASDCPELAVENASLNC
SSSDRYHGARCTVSCRTGYVLQIQRDDELIKSQVGPSVTVTCSEGKWNKQVACEPVDCGV
PDQHHVHAASFSCLQGTTFGSKCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCL
APPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKIQCTQDGSWQE
GACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDTAQGRGSNIIHCRKDGTWSGS
FHICQEMQGQCSAPDQLNGNLKLQCPEGYAIGSECVTSCLDHNSESIILPVNVTVRDIPH
WLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCAST
VKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHG
Download sequence
Identical sequences M3XRH9
ENSMPUP00000001679 ENSMPUP00000001679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]