SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001881 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001881
Domain Number 1 Region: 301-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-54
Family SPRY domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 18-89
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-20
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Domain Number 3 Region: 106-165
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000275
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001881   Gene: ENSMPUG00000001898   Transcript: ENSMPUT00000001919
Sequence length 479
Comment pep:novel scaffold:MusPutFur1.0:GL897113.1:2917158:2919002:-1 gene:ENSMPUG00000001898 transcript:ENSMPUT00000001919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSSLCWCGCSPMAVPAALAGLQAEANCPVCLDYLRDPVTTECGHNFCRCCIQQSWADL
KDRFPCPVCRHACQERHLRSNTQLGRMIDIAKLLHVTTTKKRKLEEEHLCEKHNQVLTLF
CEEDLEVLCPTCTQPPDHQGHLVRPVEEAASHHRQRLSHYIRQLKRQVADVQKLVATQDR
KLLELREMVQYQSQKLTSEFEHLNECIDREQEAVLARLAEEERDIQQKLCVNITTLSDHV
FTVRRLLNQVAERSVMSEVKLLTGVRRIQDRCAGLKPPALYSFQLRTEGCSLPPQYLALQ
KVIQKFRQEVTLDPETAHPNLLVSEDKKSVTFVRRKPGIPQNPKRFLVVLGSQGFDGGRH
YWEVQVGNKREWAVGLCKDPLSKKGKRPPSGGHSCWTIRLQDGGYVAQGAAPVTLALKEK
PKGVGIYLDYELGEISFYSLNDRSHIHSFMDTFSEVLKPYFCVGHDSKPLTICAVRDYE
Download sequence
Identical sequences M3XS31
ENSMPUP00000001881 ENSMPUP00000001881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]