SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002083 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002083
Domain Number 1 Region: 40-342
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.17e-56
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 1055-1287
Classification Level Classification E-value
Superfamily RNI-like 6.08e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.022
Further Details:      
 
Domain Number 3 Region: 628-706
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000297
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002083   Gene: ENSMPUG00000002104   Transcript: ENSMPUT00000002126
Sequence length 1310
Comment pep:known scaffold:MusPutFur1.0:GL896936.1:4023519:4145005:1 gene:ENSMPUG00000002104 transcript:ENSMPUT00000002126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEKDSGRRLRPIDRQRYDENEDLSDVEEIVSVRGFSLEEKLRSQLYQGDFVHAMEGKD
FNYEYVQREALRVPLIFREKDGLGIKMPDPDFTVRDVKLLVGSRRLVDVMDVNTQKGTEM
SMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQ
TEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNL
ALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVFGGNILH
SFNVPMQLRIYEIEDRTRVQPKFRYPFYYEMCWYVLERYVYCVTQRSYLTQEYQRESMLI
DALRKPSIDGFSSDSWLEMEEESCEQQPQEEEKEEEEEEEEEEEGAEKVPKPPADGPPSP
SSTPSEDQEASGKKPKAPALRFLQRTLSNESEESVKSTTVPTDYPKTPTGSPATGVSAKW
THLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHADDDPSLAITG
VPVVTWPKKTPKNRAVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGE
CHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLM
ECSICNEIIHPGCLKIKESEGVVNDELPNCWECPKCNHAGKTGKQKRGPGFKYASNLPGS
LLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKVPPDGILRRKSDDVHLRRKRKY
EKPQELSGRKRASTLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQLKPGKEDKLFR
KKRRSWKNAEDRMALANKPLRRFKQEPEDDLPEAPPKARESDHSRSSSPTAGPSTEGAEG
PEEKKKVKIRRKRRLPTKELSKELSKELNQEIQKTENSLANENHQPIKSEPESESEEPKR
PLGLCERPHRFSKGLTGPPRELRHQLGPGLRSPPRVISRPPPSVSPPKCIQMERHVIRPP
PISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTRID
LNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIAVSA
LCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDIT
DASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLSDCNKVTDQCL
SFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
Download sequence
Identical sequences M3XSN3
ENSMPUP00000002083 ENSMPUP00000002083 XP_012911954.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]