SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002192 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002192
Domain Number 1 Region: 335-404
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000288
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002192   Gene: ENSMPUG00000002214   Transcript: ENSMPUT00000002236
Sequence length 419
Comment pep:known scaffold:MusPutFur1.0:GL897192.1:1113515:1139369:1 gene:ENSMPUG00000002214 transcript:ENSMPUT00000002236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEQEKDPISLKRVRGGDSGLDGLGGPGVQLGSPDKKKRKTNTQGPSFPPLSEYAPPPN
PNSDHLVAANPFDDNYNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCG
PYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALNQNVNMPNQHFRQNP
AENFNQIPPQNANQVSNPDLSSNFVPGNNANFTSPLESNHSFIPPPNTFSQAKAPPQKQD
FSQGATKNTNQNSSAHPPHLNMDDTVNQSNIELKNVNRNNAVNQENSRSSTTEATNNSHA
NGTQNKPRQPRGAPDTCTTEKSNKSSLHPSRHGHSSSDPVYPCGICTNEVNDDQDAILCE
ASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTRETFGPPAVGSDA
Download sequence
Identical sequences M3XSZ2
ENSMPUP00000002192 ENSMPUP00000002192 XP_004779280.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]