SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002491 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002491
Domain Number 1 Region: 119-159
Classification Level Classification E-value
Superfamily WW domain 0.000000000000757
Family WW domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002491   Gene: ENSMPUG00000002520   Transcript: ENSMPUT00000002543
Sequence length 400
Comment pep:known scaffold:MusPutFur1.0:GL896947.1:695495:828930:-1 gene:ENSMPUG00000002520 transcript:ENSMPUT00000002543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPASVPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLASGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNPMNLHSAATSTPAPQR
SMAVSQPNLVMNHQHQQQMAPTPLSQQNHPPQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLATVQAAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGDNTGQTAMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Download sequence
Identical sequences G9KY56
ENSMPUP00000002491 ENSMPUP00000002491 XP_004755577.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]