SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002516 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002516
Domain Number 1 Region: 3-111,168-193
Classification Level Classification E-value
Superfamily Chromo domain-like 2.2e-24
Family Chromo barrel domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002516   Gene: ENSMPUG00000002545   Transcript: ENSMPUT00000002568
Sequence length 522
Comment pep:known scaffold:MusPutFur1.0:GL896965.1:1779399:1798915:1 gene:ENSMPUG00000002545 transcript:ENSMPUT00000002568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWN
RSWDRWAAEDHVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKSLPVEE
KDENDENSISSSSADSSEEKDEEISEESDIEEKTEVKEEPELHTKREMEERTITIEIPEV
LKKKLEDDCYYINRRKRLVKLPCQTNIITILESYVKHFAINAAFSANERPRHHHAMPHAN
MNVHYIPAEKNVDLCKEMVDGVRITFDYTLPLLLLYPYEQVQYKKVTSSKFFLPIKESAT
NTNRNQEELSPSPPLLNPSTPQSTESQPATGEPATPKRRKAEPEALQSLRRSTRHSANCD
RLSESSASPQPKRRQQDTPSSMPKLFLHLEKKTPVHSRSSSPVPLTPSKEGSAVFAGFEG
RRTNEINEVLSWKLVPDSYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKA
LLKHFDLFLRFLAEYHDDFFPESAYVAACEAHYSTKNPRAIY
Download sequence
Identical sequences M3XTW6
ENSMPUP00000002516 ENSMPUP00000002516 XP_004758888.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]