SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002592 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002592
Domain Number 1 Region: 85-250
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-38
Family CRAL/TRIO domain 0.0024
Further Details:      
 
Domain Number 2 Region: 318-456
Classification Level Classification E-value
Superfamily PapD-like 2.59e-37
Family MSP-like 0.000000237
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000327
Family CRAL/TRIO N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002592   Gene: ENSMPUG00000002622   Transcript: ENSMPUT00000002646
Sequence length 518
Comment pep:known scaffold:MusPutFur1.0:GL896965.1:4547110:4609417:1 gene:ENSMPUG00000002622 transcript:ENSMPUT00000002646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEYHAQNKAKLISETRRRFEAEYVTDKPDKYDPRDVERLQQDDNWVESYLVWRHNIVDE
TLKMLDESFQWRKEMCVNDLTESSIPRWLLEIGGIYLHGYDKEGNKLFWIRVKYHVKDHK
TMLDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS
KMVIFDMPWIMNAAFKIVKSWLGPEAVSLLKFTSKSDIQDYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPIASEDEASSKEDLESDGKETLETVSNEEQTTLLKKINLTEHT
SKAEENEKVDSKMKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV
AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
AELTQFWKEVPRNKVMEHRLRCHIVESSKPTTLTLKDGALAMSDKTSEDLYLQLNRLLES
NRKLEDQVQRCIWFQQLLLSLTMLLLAFVISFFYLLYS
Download sequence
Identical sequences M3XU42
ENSMPUP00000002592 XP_004758932.1.14098 ENSMPUP00000002592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]