SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002671 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002671
Domain Number 1 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 5 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-23
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 7 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.23e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 615-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-18
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 10 Region: 312-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000913
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002671
Domain Number - Region: 169-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000252
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002671   Gene: ENSMPUG00000002699   Transcript: ENSMPUT00000002726
Sequence length 673
Comment pep:novel scaffold:MusPutFur1.0:GL897208.1:1097864:1110095:-1 gene:ENSMPUG00000002699 transcript:ENSMPUT00000002726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSQISFEDVAVDFTSEEWQLLNPTQKSLYRDVMLENYSNLVFLGYQIIRPDAVFKPEP
EEPWVTEAAPRRAAAEEVWLDNSLKMWHQDNQDKLRSVERGHEYDVFRKIFHSSINFVHL
AMRPHKCGSGEKSLKHPFEFLIPKNNRGRKKPDELNKKYLLYIKADRTHGGEPYCDCSKC
RKASRTGSWPRANHRTHTGVHLCMDCGSVFNKKSQLIVHQRTHTGEKPYGCSDCGKAFSQ
KSLLTIHQRTHSGEKPYGCGECQKAFSRKSLLILHQRTHTGEKPYGCGDCGKAFSRKSQL
KRHQRTHTVEKPYGCSDCGKAFSQKFKLITHQRTHTGEKPYNCSDCGKAFFWKSQLITHQ
RTHTGKKPYACTECTKAFSRNSLLIRHQRIHTGEKPYECGECGEAFIRKPQLIKHQLTHT
GEKNYQCGDCEEAFFKKSELLRHQKTHLGEKPYGCVECGKTFFGKSQLLTHQRTHTGEKP
YECGECGKAFTQKSSLISHQRTHTGEKPYECTQCGKTFSEKSSLIHHQRTHTGEKPFECS
ECRKAFAWKPQLLRHQRIHTGEKPYECGECGKAFVQKVQLIKHQRNHTGEKTYGCSECAK
AFFEKAQLVIHQRIHTGERPYQCGECGKAFTRKSHLMRHQRIHTGDKYSGCGECGTTFRR
ESQLTLHQRTHAL
Download sequence
Identical sequences M3XUC1
ENSMPUP00000002671 ENSMPUP00000002671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]