SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002691 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002691
Domain Number 1 Region: 103-305
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.22e-75
Family T-box 0.00000000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002691   Gene: ENSMPUG00000002720   Transcript: ENSMPUT00000002747
Sequence length 757
Comment pep:novel scaffold:MusPutFur1.0:GL896936.1:7971092:7985135:-1 gene:ENSMPUG00000002720 transcript:ENSMPUT00000002747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL
AKPIMDQLVGAAETGLPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRG
TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQT
ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFDDRHKKENGTSDESSSEQAAFNCFAQSSSPAVSTV
GTSNLKDLCPSEGESDAEADSKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE
PGGXXXXXXXXXXXXXXXRDAGRLDKASPDSRHSPATISSSTRGLGAEERRSPGREGAAT
SKAEEARALPGKEAFAPLTVQTDAAAAHLGQGPLPGLGFAPGLAGQQFFNGHPLFLHPGQ
FAMGGAFSSMAAGMGPLLATVSGASTGVSGLDSTAMASAAAQGLSGASAATLPFHLQPHV
LASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIP
MPVPDSSSLLATALPSMAAAAGPLDGKAAALAASPASVAVDSGSELNSRASTLSSSSVSL
SPKLCPEKEAATSELQNIQRLVSGLEAKPDRSRSGSP
Download sequence
Identical sequences M3XUE1
ENSMPUP00000002691 ENSMPUP00000002691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]