SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002698 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002698
Domain Number 1 Region: 269-458
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-37
Family Laminin G-like module 0.00000957
Further Details:      
 
Domain Number 2 Region: 472-671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-28
Family Laminin G-like module 0.000052
Further Details:      
 
Domain Number 3 Region: 41-93
Classification Level Classification E-value
Superfamily GLA-domain 7.06e-20
Family GLA-domain 0.00056
Further Details:      
 
Domain Number 4 Region: 119-291
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000377
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002698   Gene: ENSMPUG00000002727   Transcript: ENSMPUT00000002754
Sequence length 678
Comment pep:novel scaffold:MusPutFur1.0:GL897075.1:4029801:4072278:1 gene:ENSMPUG00000002727 transcript:ENSMPUT00000002754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQALYVRFIFYKMMVAILFSSPINLFLSKQDASQVLVRKRRAYSMFEETKKGNLERECIE
ELCNKEEAREIFENDPETDYFYPKYLGCLGSFRAGLFTAARQSTEAHPDLRSCVTAIPDQ
CSPLPCNEDGYKSCRDGQATFTCICKPGWQGDKCEYDINECKDPSNVNGGCSQICDNTPG
SYRCSCKSGFFMLLNKKDCKEIGNNFLLPPSPPSSSLAPSFLSSLPLCASPFGYEVEQYM
ISCNPDVDECSENICAQLCVNYPGGFSCYCDGKKGFKLAQDHKSCEAVPVCLPLNLDKNY
ELLYLAEQFVGVALYLKFRLPEITRFSAHFDFRTYDSEGVVLYAESLDHSAWFLIALRDG
KIEIQFKNEFTTKIISGGKVINNGHWNMVSVEELEHSISVKISKEAVMNINKPESLFKLT
SGFLETKVYFAGLPRKAENTLVRPINPRLDGCIRSWNLMGQGASGIKEIIQEKQNKHCLV
AVEKGSYYPGSGVAQFSIDYSNLSNVEDWQVNASLSIRPSTGTGVMFALVSGSTVPFALS
LVDSASEKLQDILVSVENTVMYRMDAVSLCSNQPFHLELRVNRNNLELFTPLKKDTISSE
NLQRQLAILDEAMKGTVTTYLGGLPDIPFNATPVNAFYNGCMEVNINGVQLDLDEAVSKH
NDIRAHSCPTISNNTKNS
Download sequence
Identical sequences M3XUE8
ENSMPUP00000002698 ENSMPUP00000002698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]