SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002833 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002833
Domain Number 1 Region: 40-155
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.54e-37
Family MBT repeat 0.00000682
Further Details:      
 
Domain Number 2 Region: 130-231
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.2e-35
Family MBT repeat 0.00000151
Further Details:      
 
Domain Number 3 Region: 603-684
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.81e-19
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002833   Gene: ENSMPUG00000002862   Transcript: ENSMPUT00000002892
Sequence length 686
Comment pep:known scaffold:MusPutFur1.0:GL896965.1:7698787:7807189:-1 gene:ENSMPUG00000002862 transcript:ENSMPUT00000002892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKKENQEKPPHSGTSVQNDDFHWENYLKETGSLSAPSECFRQSKVPPANDFKVGMKLE
AHDPRNMTSICIATVVGITGARLRLRLDGSDNRNDFWRLVDSPDIQPIGTCEKEGDLLQP
PLGYQMNASSWPMFLLRTLNGSEMAPATIFKKEPPKPPLNNFKVGMKLEAIDKKNPYLIC
PATIGDVRGDEVYITFDGWSGAFDYWCKYDCRDIFPVGWCRLTGDVLQPPGTHVPVTKNI
AKTQSSLSKATQHSMQSPQKTAVILPTQQIRKSGRIKPPGQTSVPKKGSAVKNITPRKKG
PKKEKYFPVLCSTSSASIKSLARDRRVSYDKDATPGTSKIVMSTVCVYVNKHGNSGPHLD
QKKIQQLPDHFGPGPVNVVLRRTVQACVDCAIESKTVFGFLKPDHRGGEVITASFDGETH
SIQLPPVNSASFALRFLETLCHSLQCDNLLSSQPFSSYRGNTSSPAEHDKKSVKEDITQK
SPKRPSQEPPPYVVPVSPKLPKTKVYASKEEQLSCEGSGMPKEEKLPEDSENSPPNPANS
LSPTSRNPVSTHAAVSWSFSPSAPSTSSSALVGTKSTKSSHHEVKFQMQRKSEAPSYIAV
PDPSVLKQGFSKDPSTWSVDEVIQFMKHKDPQISGPLADLFRQHEIDGKALLLLKSDVMM
KYMGLKLGPALKLCYYIEKLKEGKYN
Download sequence
Identical sequences M3XUT3
ENSMPUP00000002833 ENSMPUP00000002833 XP_004758983.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]