SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002884 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002884
Domain Number 1 Region: 133-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000578
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 177-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000407
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 3 Region: 82-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002884
Domain Number - Region: 46-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0765
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002884   Gene: ENSMPUG00000002913   Transcript: ENSMPUT00000002943
Sequence length 417
Comment pep:novel scaffold:MusPutFur1.0:GL896921.1:240445:319923:-1 gene:ENSMPUG00000002913 transcript:ENSMPUT00000002943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSMAGLAGVCTMRNGHLWLLPGLLMLLLLPLRAAAQKTSDCARWCPPNSTCANATACR
CSPGFNSSSGVIFTSLLEICEDINECGPLSAVSCGKFADCQNTEGSYYCTCIPGYELASG
ARMFKNESENTCQDVNECTSGQNPCHSSAHCLNIISGYKCRCRPGWKPIPGSPNGPSNTV
CEDVDECSSMQTTCHKSTICINAVGSYKCRCRRGWEPKPGFQDNQLNTTCEEMSFPTWTP
PPRIKSQRLSHFFERVQGLGRHFKPALAQDTIQDLIQVVDELLQTPEDLETLSRSDQHCV
ATSLLGGLEDVLRNLSQALPSGTLTFNASAGTGAPFPGPLDRENWLFSETFFVVCTCWHF
WTASLFSSKPGIDEAKQELVGLTTAELFGPKVLVLSSFPVCFRVVFMFCMKLFIFNL
Download sequence
Identical sequences M3XUY4
ENSMPUP00000002884 ENSMPUP00000002884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]