SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002913 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002913
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-41
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000244
Further Details:      
 
Domain Number 2 Region: 403-439
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000706
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002913   Gene: ENSMPUG00000002942   Transcript: ENSMPUT00000002972
Sequence length 443
Comment pep:novel scaffold:MusPutFur1.0:GL896944.1:3911062:3978252:-1 gene:ENSMPUG00000002942 transcript:ENSMPUT00000002972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQ
VVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGG
PSTQRQVQNGPSPEEMDIQRRQVMEQQHQQQRQESLERRTSAAGPILPPGHPSSAASAPL
SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGAQGA
SHDESSVSGLAAALAGAKLRRVQRPEDASGGSSPSGTSKSDTNRASSGGGGGGLMEEMNK
LLAKRRKAASQTDRPADKKEDESQAEEPSTSPSPGTRAASQPPNSSEAGRKPWERSNSVE
KPVSSLLSRTPSVAKSPEAKSPLQAQPHARMKPVGSVNDVALDALDLDRMKQEILEEVVR
ELHKVKEEIIDAIRQELSGISTS
Download sequence
Identical sequences M3XV13
ENSMPUP00000002913 ENSMPUP00000002913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]