SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003141 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003141
Domain Number 1 Region: 892-1073
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.02e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 
Domain Number 2 Region: 1048-1169
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 191-221,314-443
Classification Level Classification E-value
Superfamily PH domain-like 3.5e-28
Family Phosphotyrosine-binding domain (PTB) 0.0062
Further Details:      
 
Domain Number 4 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 8.47e-22
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003141
Domain Number - Region: 1173-1256
Classification Level Classification E-value
Superfamily Tropomyosin 0.032
Family Tropomyosin 0.0088
Further Details:      
 
Domain Number - Region: 438-499
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.068
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003141   Gene: ENSMPUG00000003174   Transcript: ENSMPUT00000003206
Sequence length 1299
Comment pep:known scaffold:MusPutFur1.0:GL896942.1:141027:334692:-1 gene:ENSMPUG00000003174 transcript:ENSMPUT00000003206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIQDEPFPHPLEPEPGALAQPGLGKPGDKRFRLWYVGGSCLDRRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVLLVLSAPFLRCVPAPGVGAAGGVGPAAAQPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPNQVPDVISSIRQLSKA
AMKEDAKASKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCIEKFSLHEQQRLKIQ
GEQRGADAGDDPGVFEATAPCPAADILAEEGDGVPDILPTLPATASQPGLPSSRAGFPER
ILEDSGFDEQQEFRSRCSSVTGVLQKKVHENSQKPLPRRRHASAPSHVQPSDSEKNRTML
FQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESAEPGLGQYICYVF
QCASESLVDEVMLTLRQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKL
VIQRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHIHIGEGPST
ISNSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSMDSFERSNSL
ASEKDYSPGDSPPGTPPASPLSSAWHMFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQD
GRAHGVRSPLLRQSSSEQCSILPSVRRMPKESISSTSLPSLHTSFSAPSFTAPSFLKSFY
QNSGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLNAGGTPVTPRRISWRQRIFL
RVASPMNKSPSAMQQDGLDRNELLPLSPLAPTMEEEPLVIFVSGEDDPEKAEERKKSEEL
RSLWKKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGVCQKEVLITWDKKLLN
CRAKIRCDMEDIHVSLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQL
TAQQHAILVDLGRTFPTHPYFSAQLGAGQLSLFNLLKAYSLLDQEVGYCQGISFVAGVLL
LHMSEEQAFEMLKFLMYDQGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEIS
PSLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSSQEALIMECENFES
IVEFLKTTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYACEESEPV
EKLERANSQLKRQNMELLEKLQIAHAKIQSLESSLENLLTRETKMKSLIRTLEQEKMAYQ
KTVDQIRKLLPADVLANCEPLLRDLNCNPNNKAKTGNKP
Download sequence
Identical sequences M3XVP1
ENSMPUP00000003141 ENSMPUP00000003141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]