SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003204 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003204
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily F-box domain 1.44e-16
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 98-259,332-391
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000392
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003204   Gene: ENSMPUG00000003237   Transcript: ENSMPUT00000003269
Sequence length 428
Comment pep:novel scaffold:MusPutFur1.0:GL896942.1:1653489:1665282:-1 gene:ENSMPUG00000003237 transcript:ENSMPUT00000003269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGGRDSDHNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
Download sequence
Identical sequences E2RJX6 F7FSR9 M3XVV4
ENSCAFP00000007558 ENSMPUP00000003204 ENSMPUP00000003204 ENSCJAP00000039464 ENSCAFP00000007558 XP_002742655.1.60252 XP_004754466.1.14098 XP_021553516.1.83697 XP_542618.2.84170 9615.ENSCAFP00000007558 ENSCJAP00000039464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]