SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003222 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003222
Domain Number 1 Region: 535-720,928-1067
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.42e-59
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 3759-3949
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.08e-26
Family APC10-like 0.016
Further Details:      
 
Domain Number 3 Region: 2267-2310,2392-2435
Classification Level Classification E-value
Superfamily E set domains 0.00000000534
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 4 Region: 4500-4575
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000259
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003222
Domain Number - Region: 3727-3788,4067-4146
Classification Level Classification E-value
Superfamily ARM repeat 0.00337
Family Armadillo repeat 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003222   Gene: ENSMPUG00000003254   Transcript: ENSMPUT00000003287
Sequence length 4741
Comment pep:known scaffold:MusPutFur1.0:GL896942.1:1672046:1953403:-1 gene:ENSMPUG00000003254 transcript:ENSMPUT00000003287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMCSATASPAAASSGPGGDGFFPAATISSSSAPGALFMPVPEGSVAAAGLGLGLPAADS
RGHYQLLLSGRALADRYRRIYTAALSDRDQGGSNAGHPASRNKKILNKKKLKRKQKSKSK
VKTRNKSENLENTVIIPDIKLHSNPSAFNIYCNVRHCVLEWQKKETLLAAASKNSVQSGE
SDSDEEEESKEPPIKLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEG
LQSEPPEVLESLFQLLLEITVRSTGMNDSTGQSLTALSCACLFSLVASWGETGRTLQAIS
AILTNNGSHACQTIQVPTILNSLQRSVQAVLVGKIQIQDWFSNGIKKAALMHKWPLKEIS
VDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLGYAQ
GYLLYRDVNNHSMTAIRISPETLEQDGTVMLPDCHTEGQNILFTDGEYINQIAASRDDGF
VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAGREF
ALMKTASGKIYYTGKYQSLGIKQGGPSAGKWVELPITKSPKIVHFSVGHDGSHALLVAED
GSIFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELY
MFGKDAIYSDSSSLVTDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCGRDTGAM
NQGGKGFGVENMATAMDEDLEEELDEKDEKSMMCPPGMHKWKLEQCMVCTVCGDCTGYGA
SCVSSGRPDRVPGGICGCGSGESGCAVCGCCKACARELDGQEARQRGILDAVKEMIPLDL
LLAVPVPGVNIEEHLQLRQEEKRQRVIRRHRLEEGRGPLVFAGPIFMNHREQALARLRSH
PAQLKHKRDKHKDGSGERGEKDASKITTYPPGSVRFDCELRAVQVSCGFHHSVVLMENGD
VYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSK
GQLGRPILDVPYWNAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSEI
FASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGFGVCLDPVYDVIWRF
RPNTRELWCYNAVVADARLPSAADMQSRCSILSPELALPTGSRALTTRSHAALHILGCLD
TLAAMQDLKMGVASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADT
DILLGGLGLFGGRGEYTAKIKLFELGPDGGDHETDGDLLAETDVLAYDCAAREKYAMMFD
EPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIP
QLLYRLPTSDGSASKGKQQTSEPVHILKRSFARTVSVECFESLLSILHWSWTTLVLGVEE
LRGLKGFQFTATLLDLERLRFVGSCCLRLLRVYTCEIYPVSATGKAVVEETSKLAECIGK
TRTLLRKILSEGVDHCMVKLDNDPQGYLSQPLSLLEAVLQECHNTFTACFHSFYPTPALQ
WACLCDLLNCLDQDIQEANFKTSSSRLLAAVMSALCHTSVKLTSIFPIAYDGEVLLRSIV
KQVSTENDSTLVHRFPLLVAHMEKLSQSEENISGMTSFREVLEKMLVIVVLPVRNSLRRE
NELFSSHLVSNTCGLLASIVSELTASALGSEVDGLNSLHSVKASANRFTKTSQGRSWNTG
NGSPDAICFSVDKPGIVVVGFSVYGGGGIHEYELEVLVDDSEHAGDSTHSHRWTSLELVK
GTYTTDDSPSDIAEIRLDKVVPLKENVKYAVRLRNYGSRTANGDGGMTTVQCPDGVTFTF
STCSLSSNGTNQTRGQIPQILYYRSEFDGDLQSQLLSKANEEDKNCSRALSVVSTVVRAA
KDLLHRALAVDADDIPELLSSSSLFSMLLPLIIAYIGPVAAAIPKVAVEVFGLVQQLLPS
VAILNQKYAPPAFNPNQSTDSTTGNQPEQGLSACTTSNHYAVIESEHPYKPACVMHYKVT
FPECVRWITIEFDPQCGTAQSEDVLRLLIPVRTIQNSGYGPKLTSVHENLNSWIELKKFS
GSAGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPGPDEGVIQLEK
ELANLGGVCAAALMKKDLALPIGNELEEDLEILEEAALQVCKTHSGILGKGLALSHSPTI
LEALEGNLPLQIQSNEQSFLDDFIACVPGSSGGRLARWLQPDSYADPQKTSLILNKDDIR
CGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQEQVKKPQRIPGSPAVATV
PSNTDMTFGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKRPSEN
MLIRVNNDGTYCANWTPGAIGLYTIHVTIDGIEIDAGLEVKVKDPPKGMIPPGTQLVKPK
TEPQPNKVRKFVAKDSAGLRIRSHPSLQSEQIGIVKVNGTITFIDEIHNDDGVWLRLNDE
TIKKYVPNMNGYTEAWCLSFNQHLGKSLLVPVDSIFNASQGVRDLDVFSWTSKAFFPQEP
KTNTDDFFKDINSCCPQEATMQEQDMPFLRGGPGMYKVVKTGPSGHNIRSCPNLRGIPIG
MLVLGNKVKAVGEVTNSEGAWVQLDKNSMVEFCESDEGEAWSLARDRGGNQYLRHEDEQV
LLDQNSQTPPPSPFSVQAFNKGASCSAQGFDYGLGNNKGDQLSAILNSIQSRPNLPAPSI
FDQAAKPPSSLVHSPFVFGQPLSFQQPQLQSDRGTISTSSRPVSTPGKSELPSKHSRSLK
PDGRMSRTTADQKKPRGTEGLSASESLMLKSDAAKLRSDSHSRSLSPNHNTLQTLKSDGR
MSSSFRAESPGPGSRSSSPKPKTLPANRSSPSGASSPRSSSPHDKNLPQKSTAPVKTKLD
PPRERSKSDSYTLDPDTLRKKKMPLTEPLRGRSTSPKPKPVPKDSKDSPGSENRAPSPHV
VQENLHSEVVEVCTSSTLKTNSLTDSTCDESSEFKSIDESSNKVHFSIGKAPLKDEQEMR
ASPKISRKCANRHTRPKKEKSSFLFKGDGSKPLEPAKQAMSPSVAECARAVFASFLWHEG
IVHDAMACSSFLKFNPELSKEHAPIRNSLNSQQPTEEKETKLKNRHSLEISSALNMFNIA
PHGPDISKMGSINKNKVLSMLKEPPLHEKCEDGKTEATFEMSMHHPVKSKSPLPLTLQHL
VAFWEDISLATIKAASQNMIFPSPGSCAVLKKKECEKENKKAKKDKKKKEKTEVRPRGNL
FGEMAQLAVGGPEKDTICELCGESHPYPVTYHMRQAHPGCGRYAGGQGYNSIGHFCGGWA
GNCGDGGIGGSTWYLVCDRCREKYLREKQAAAREKVKQSRRKPVQVKTPRALPTMEAHQV
IKANALFLLSLSSAAEPSILCYHPAKPFQSHLPSVKEGISEDLPVKMPCLYLQTLARHHH
ENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSLETSPIT
DTDLAKRTVFQRSYSVVASEYDKQHSILPARVKAIPRRRVNSGDTEVGSSLLRHPSPELS
RLISAHSSLSKGERNFQWPVLAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCN
VIQTTSLHDILWHFVASLTPAPVEPEEEEDEENKTNKENAEQEKDTRVCEHPLSDIVIAG
EAAHPLPHTFHRLLQTISDLMMSLPSGSSLQQMALRCWSLKFKQSDHQFLHQSNVFHHIN
NILSKSDDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDG
STETFWESGDEDKNKTKNITINCVKGINARYVSVHVDNSRDLGNKVTSMTFLTGKAVEDL
CRIKQVDLDSRHIGWVTSELPGGDNLIIKIELKGPENTLRVRQVKVLGWKDGESTKIAGQ
ISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKATSDA
DLKEHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATRVREEWEHAISSKENANSQPNDED
ASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVL
PEVTPNRLASIIGVKSLPPADISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGT
TITGTAGTTVGKGVTTVTLPMIFNSSYVRRGESHWWMKGSTPTQISEIIIKLIKDMAAGH
LSEAWSRVTKNAIAETIIALTKMEEEFRSPVRCIATTRLWLALASLCVLDQDHVDRLSSG
RWMGKDGQQKQMPMCDNHDDGETAAIILCNVCGNLCTDCDRFLHLHRRTKTHQRQVFKEE
EEAIKVDLHEGCGRTKLFWLMALADSKTMKAMVEFREHTGKPTTSSSEACRFCGSRSGTE
LSAVGSVCSDADCQEYAKIACSKTHPCGHPCGGVKNEEHCLPCLHGCDKSATTLKQDADD
MCMICFTEALSAAPAIQLDCSHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIV
LKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYK
CRKAYFGGEARCDAEAGQGDDYDPRELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVA
VFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAASCRQWRRKRRRGRRKRRKREEGRRR
G
Download sequence
Identical sequences M3XVX2
ENSMPUP00000003222 ENSMPUP00000003222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]