SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003347 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003347
Domain Number 1 Region: 692-782,813-900
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 203-482
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-30
Family FCH domain 0.072
Further Details:      
 
Domain Number 3 Region: 615-673
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000147
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003347   Gene: ENSMPUG00000003377   Transcript: ENSMPUT00000003412
Sequence length 1274
Comment pep:novel scaffold:MusPutFur1.0:GL896933.1:4599130:4655014:1 gene:ENSMPUG00000003377 transcript:ENSMPUT00000003412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAHKQKKTKKKRILSSGQLSTDVTTPEMGLKSISSNSIFDPDYIKELVNDIRKFSHMLL
YLKEAILSDCFKEVIHIRLDELLHVLKSVMNKHQNLNSLDLQNAAEMLTAKVKAVNFTEV
NEENKNDLFREVFSSIETLAFTFGNILTNFLMGDVGNDSLLRLPVSRESKSFENVSVESV
DSSNEKGNFSPIELDSVLLKNTDSVELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNV
VKLAEATRSNIGIQEFMPLQSLFTSALLNDIKNSRLLQQTIAALQANKFVQPLLGRKNEM
EKQRKEIKELWKQEQNKLLETETALKKAKLLCMQRQDEYEKAKSSMFRAEEEHLCSSGGS
VKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILTQLQKLVFQ
CDLTLKAGKLLGVRLLDVMVTVNLFQMQHLQAASLANNLQSLCDSAKLYDPGQEYSEFVK
ATNATEEEKVDGNINKPLTNSPHTSGYRPTDSLEDVVRLPDSSSKIEEDRCSNSADVTGP
SFIRSWTFGMFSDSESTGGSSESRSLDSESISPGDFHRKLPRTPSSGTMSSADDLDEREP
PSPSEAGPNSLGTFKKTLMSKAALTHKFRKLRSPTKCRDCEGIVVFQGVECEECLLVCHR
KCLENLVIICGHQKLPGKIHLFGAEFIQVAKKEPDGIPFVLKICASEIENRALCLQGIYR
VCGNKIKTEKLCQALENGMHFVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLA
KEIQHVNEEQESKKDNPEDKKWPSTCIEINRILIKSKDLLRQLPVSNFNSLHYLIVHLKR
VVDHAEENKMNSKNLGVIFGPSLIRPRPTTAPVTISSLAEYSNQARLVEFLITYSQKIFD
GSLQPQEVVVYSTGGGVPHVDQGCLPKPLLSPEERDPEHSMKTLFFSSKEDMHTVDSETK
IFEPATSFEESERKQNALEKCDTFLIDNKVGLLVNQELESASQKMEDVCKTYKPLTLKSE
RETNSVERHAPRTKVRPASLPVDRLLLLASPPNERTVRNMGNVNSDKFCKNPTFDGVSRK
DIPTIVCSKLDGFDQQTLQKTRERQYEQNGLSAKTAAGMGTVSVRIGGDQPDSAPWPSKP
YTEPVRSVRQVSERRSSDSCPPAAVRAPRTLQPQHWTTFYKPRAPTSSLRGDEERLATPS
PALPPSTAPTPQGPLLKTVPASDKAPAASTQSTSKPGENSEERDLPEVPPACQRPRLKRM
QQFEDLEDEIPQFV
Download sequence
Identical sequences M3XW97
ENSMPUP00000003347 ENSMPUP00000003347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]