SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003606 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003606
Domain Number 1 Region: 6-231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.98e-58
Family BAR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 242-435
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003606   Gene: ENSMPUG00000003635   Transcript: ENSMPUT00000003673
Sequence length 759
Comment pep:novel scaffold:MusPutFur1.0:GL896973.1:2360650:2434319:-1 gene:ENSMPUG00000003635 transcript:ENSMPUT00000003673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLNFLFRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGAEADKRSKKLP
LTTLAQCLVEGSAILGDDTLLGKMLKLCGEAEDKLAQELIHFELQVERDVIEPLFLLAEV
EIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSGLQPAGAKADALREEMEEAANRV
EICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLALLQAVLPQIKAQQEAWVEK
PSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLKKLKAALDCCV
VDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRLQALWNACEKL
PKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNITEMMTTVSLQI
VGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPADRRQPEQARR
PLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTSWVARRGSSAGRKASCAPPTMQPPAPPA
ELAAPLPSPLPEQPLDGPAVPSLSPSGLGLQPGAERTSTAKSKELSPGSGQKGSPGSSQG
TPGAGTQPGPQAGPSPSQPPPDQSPHTLRKVSKKLAPIPPKVPFGQPGAVTEQSAGQPSP
LSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAAPPLASPAGFTSSAAKARPTPKPRQR
PTLPPPQPPTVSLPAPSPQSTEHPVLDGMAPGESMSTAV
Download sequence
Identical sequences M3XX06
ENSMPUP00000003606 ENSMPUP00000003606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]