SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003626 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003626
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.57e-17
Family THAP domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003626   Gene: ENSMPUG00000003655   Transcript: ENSMPUT00000003693
Sequence length 313
Comment pep:known scaffold:MusPutFur1.0:GL896906.1:2258067:2260158:-1 gene:ENSMPUG00000003655 transcript:ENSMPUT00000003693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEY
IYFCSKHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPPDVSRL
RRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPAALPASPTGRLEAGLSSPFSDLLG
PLGAQADEAGCSAQPSPEREPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGS
ALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLNKLQQERAREKRAQADARQTLKEH
VQDFAMQLSSSMA
Download sequence
Identical sequences M3XX26
ENSMPUP00000003626 ENSMPUP00000003626 XP_004742621.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]