SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003703 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003703
Domain Number 1 Region: 620-915
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-73
Family Protein kinases, catalytic subunit 0.000000747
Further Details:      
 
Domain Number 2 Region: 98-256
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.04e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003703   Gene: ENSMPUG00000003733   Transcript: ENSMPUT00000003771
Sequence length 924
Comment pep:novel scaffold:MusPutFur1.0:GL896927.1:993314:1058017:1 gene:ENSMPUG00000003733 transcript:ENSMPUT00000003771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLASHPGPVPANSVMNWIEVVRNHVLNVPEGFAVQGNPALWKVESYSVTWSLSQRFMSS
APVPAPSSELTPVPRMPLVLLLLLPLLSSVKAQVNPAICRYPLGMSGGHIPDEDITASSQ
WSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHG
IEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTD
HSMNVCMRVELYGCVWLDGLVSYSAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQ
LTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESAPSGYIEIMFEFDRIRNFTTMKVHCNNM
FAKGVKIFKEVQCYFRSEANEWEPNAVSFPLVLDDVNPSARFVTVPLHHRMASAIKCQYH
FADTWMMFSEITFQSDAAMYNNSGALPTSPVAPTTYDPMLKVDDSNTRILIGCLVAIIFI
LLAIIVIILWRQFWQKMLEKASRRMLDDEMTVSLSLPSESSMFNNNRSSSPSEQESNSTY
DRIFPLRPDYQEPSRLIRKLPEFAPGEEESGCSGIVKPAQPSGPEGAPHYAEADIVNLQG
VTGGNTYSVPAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDK
DFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCITDDPLC
MITEYMENGDLNQFLSRHEPPSSASSNAPTVSYANLKFMATQIASGMKYLSSLNFVHRDL
ATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVW
AFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAVCPDSVYKLMLSC
WRRDTKHRPSFQEIHLLLLQQGDE
Download sequence
Identical sequences M3XXA3
XP_004751473.1.14098 ENSMPUP00000003703 ENSMPUP00000003703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]