SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003712 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003712
Domain Number 1 Region: 4-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.75e-78
Family BAR domain 0.00066
Further Details:      
 
Domain Number 2 Region: 407-522
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 616-735
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-25
Family Ankyrin repeat 0.00065
Further Details:      
 
Domain Number 4 Region: 260-372
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-24
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003712   Gene: ENSMPUG00000003742   Transcript: ENSMPUT00000003780
Sequence length 785
Comment pep:novel scaffold:MusPutFur1.0:GL896912.1:13033010:13180024:-1 gene:ENSMPUG00000003742 transcript:ENSMPUT00000003780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIVMIDTGKAFCVANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRKKPDHIRRWFSIQN
NQLVYQKKFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWI
KAVQTSIATAYREKGDESEKLDKKSSPSTGSLDSGNESKDKLLKGESALQRVQCIPGNAS
CCDCGLADPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGND
VINRVYEAKVEKMGIKKPQPGQRQEKEAYIKAKYVERKFVDKYSMSSSPPEQEKKTVSKS
SEEKRLSISKLGPSDQVRVPPQSSVKSNDSGIQQSSDDGRESLPSTVSANSLYETEGERQ
DSSVFLDSKHFNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGS
LVTCEFLLQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLTI
AVEAANADIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQ
DSQKF
Download sequence
Identical sequences M3XXB2
XP_012908073.1.14098 ENSMPUP00000003712 ENSMPUP00000003712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]