SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003864 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000003864
Domain Number - Region: 25-102
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00785
Family BAR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003864   Gene: ENSMPUG00000003894   Transcript: ENSMPUT00000003933
Sequence length 779
Comment pep:known scaffold:MusPutFur1.0:GL896924.1:3162970:3194580:-1 gene:ENSMPUG00000003894 transcript:ENSMPUT00000003933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFVTEVLAHSGRLEKEDLGTRISRLTRRVEEIKGEVCTMISKKYSEFLPSMQSAQDLV
TQVDKLSEDIDLLKSRIESEVRRDLHVSTAEFTDLKQQLERDSVVLSLLKQLQQFSAAIE
EYNCALTEKKYVTAAQCLEEAQKCLKLLKSRKCLDLKMLKSLSMELTIQKQNILYHLGEE
WQKLIVWKFPPSKDTSNLESCLQTELHLCIEQSQKEEKTPVPPISSVLLAFSILGELQMK
LKSFGQMLLKYILRPLASCPSLHAIIESQPNIIIIRFESVMTDLEHPSPSEVFVKIRLVL
EMLQKQLLDLPLDTDLENEKTPKIVLAEMLGDVVWEDLSECLIKNCLVYSIPTNSSKLQQ
YEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIH
NTVKITPDSKVSVPDLPRPEEDEKPEVQKMSTTQYNEVVNLEPENTLDQHSFSLPTCRIS
ESVKQLMELAYQTLLEAITSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAI
HHNNCMYIAHHLLTLGHQFRSRFAPILCDGTTTFVDLVPGFRRLGTECFLGQMRAQKGEL
LERLSSARNFSNMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTA
ISEIIGRITVLEDISTEDADRLYSLCKTVMDEGPQVFAPLSEESKNKKYQEEVPVFVPKW
MPFKELMMILQASLQEIGDRWADGKGPLAAAFSSSEVRALIRALFQNTERRAAALAKIK
Download sequence
Identical sequences M3XXR3
ENSMPUP00000003864 ENSMPUP00000003864 XP_004749914.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]