SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003949 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003949
Domain Number 1 Region: 970-1092
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.31e-26
Family Ankyrin repeat 0.000000271
Further Details:      
 
Domain Number 2 Region: 47-128
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.24e-22
Family Ras-binding domain, RBD 0.014
Further Details:      
 
Domain Number 3 Region: 1098-1159
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-16
Family SH3-domain 0.000066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003949   Gene: ENSMPUG00000003981   Transcript: ENSMPUT00000004020
Sequence length 1168
Comment pep:known scaffold:MusPutFur1.0:GL896982.1:122780:158492:-1 gene:ENSMPUG00000003981 transcript:ENSMPUT00000004020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPMICRSSGRLEVCEHRQSFLCFSRYARTCVEEVLMGCHLRFICWMFLTVYLSDSEQHF
TEVPVTPETMCRDVVDLCKEPGESECHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVR
FFLRHERPPGRDTVSGPRTQDPSLKRNGVKVPAEHRRKENGVNSPRMDLTLAELQEMASR
QQQQIEAQQQMLATKEQRLKFLKQQDQRQQQQAAEQEKLKRLKEMAENQEAKLKKVRALK
GHVEQKRLSNGRLVEEIEQMNSLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDGRHDSR
SAAAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKA
ALQQKESLPVSSDGNLPPQGLPAPSRVAAVGPYIQSSTMPRVPSRPELLVKPALPDSSLA
MQAPEGPLKVHTLPNMRSGPAFQGQGSKIHLLGPDWSSPSADISASQSSVPASSGDAPDQ
GDDGEVALREKEKKVRPFSMFDTVDQCAAPPPFGALRKNQSSEDILRDAQAASKNVAKVP
PPVPSKPKQINLPYFGQNPQSASDLKPDGNPPQLSAGVASVGSKLKSGQPQRVVVPPGAP
SASQSQALSAAGKQESPPAAAVRPFTPQPSKDTPPPPLRKPQTVAASSIYSMYTQRQAPG
KNFQQAVQSALTKTHSRGPPFSTVYGKPVIAAAQNQQLHLENVYSSSQSQPGSPEPDVEP
VASGQESHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITE
PEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKPTSVVADSDSPIETQNPYLHVEPEKET
VSLIPEPVSPEDVGSASSENSDMAALSPGLDYMPEGVLDSSPSFQNSAEEPSAEAPHPLE
VYLEEYPPYPPPPYPSGEPEGPGEDSGSMRPPEVTGQVSLPPGKRTNLRKTGSERIAHGM
RVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQ
FGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFATTYSDLQTAADKCEETEEGY
TQCSQFLYGVQEKMGIMNKGVLYALWDYEPQNGDELPLRDGDCMTVIRREDEEETEWWWA
RLHDKEGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences M3XXZ8
ENSMPUP00000003949 ENSMPUP00000003949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]