SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004024 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004024
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-32
Family PWWP domain 0.00000798
Further Details:      
 
Domain Number 2 Region: 347-426
Classification Level Classification E-value
Superfamily HIV integrase-binding domain 6.41e-30
Family HIV integrase-binding domain 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004024   Gene: ENSMPUG00000004058   Transcript: ENSMPUT00000004097
Sequence length 531
Comment pep:novel scaffold:MusPutFur1.0:GL897013.1:3075875:3116655:1 gene:ENSMPUG00000004058 transcript:ENSMPUT00000004097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQASTKQSNASSDVEVEEKETSVSKE
DTDHEEKASNEDVTKAIDITTPKAARRGRKRKAEKQIETEEAGVVTTATASVNLKVSPKR
GRPAATEVKIPKPRGRPKMVKQPCPSESDMVTEEDKSKKKGQEEKQPKKQLKKDEDGQKE
EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQESEKKRKGGRNFQNPHRR
NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
GSDAQDSNQPQHNGDSSEESKDNHEASSKKKSSSEERETERETLKDSTLDN
Download sequence
Identical sequences M3XY73
ENSMPUP00000004024 XP_004765779.1.14098 XP_004765780.1.14098 ENSMPUP00000004024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]