SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004062 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004062
Domain Number 1 Region: 1372-1441
Classification Level Classification E-value
Superfamily SH3-domain 1.14e-18
Family SH3-domain 0.00036
Further Details:      
 
Domain Number 2 Region: 1236-1315
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000158
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 304-363
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000042
Family SH3-domain 0.000021
Further Details:      
 
Domain Number 4 Region: 421-579
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000201
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 5 Region: 601-714
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000454
Family Fibronectin type III 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004062   Gene: ENSMPUG00000004096   Transcript: ENSMPUT00000004135
Sequence length 1441
Comment pep:novel scaffold:MusPutFur1.0:GL897166.1:383518:477616:1 gene:ENSMPUG00000004096 transcript:ENSMPUT00000004135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASRENELKDAAQRQHRLRPHDAGLPARAWQPDKVRAEHACLCHALAVVIRERDLAVKE
KHQLQAKLENLEQVLKHMREAAERRQQLELEHEQALAVLHAKQQEIDLLQKAQVEAKKEH
EGAVRLLENTLDGMQSKVRELEEKCRTQSEQFSLLSQDLERLRQHAGKIDLLGGSAGTSL
DVPSKGKCPPLPPRRGVGVPCDGTFSSHAPTPLPPNHPQGHTPRPSTLALSAWRVPRRGS
GKGPPQVHSWALDLLLPKACRTPDSAVGADTYELDANKQHALLSSPSTSNASLTVSVSLP
GLIYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLVPSNFVDFVQD
NESRLGTEQDQNLINHASIGLEGENILDLHAPTHIDAGVTDNGAGTLGVNIDEIGEDIVP
YPRKITLIKQLARSVIVAWEPPAVPPGWGTVSSYNVLVDQETRVSLMLGSRTKALIEKLN
TAACTYRISVQCITSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNY
SHVIFLNEEELDVVKAARYKYQFLNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVE
FSTLPAGPPAPPQDVTVHAGATPATIQVSWKPPALTTSGLSNGANVSGYGVYAKGQRVAE
VISPVADSIAVEIVRLRSLEAKAVTVRTLSAQGESMDSAPAAIPPDLLVPPTPHPRTAPT
PKPLASAGAPDTKDEHLGPHVAMDGAWEQGGVPAPAHGHMLEPPSLQGSGPGRRSPSPSR
ILPQPQGTPVSTSVAKAMAREAAQRVAESSRDAAAPPEALIPPGGVPRAGWSQARECCPH
ASSLFGSTLREAPGLSVQQMGRPGESGSVRTSGREDTADSGTHGSSILLESSRGSDLSDI
MEEDEEELYSEMQLEDGGRRRPSGTSHNALKKNPCWGAPEECSQSSGSEGAFLEPPEHPH
LTQHSSRLFSIPEVAEEGEHLEVLHKQGLGYSARARAPPASRLPAKPRGPGGGPHAEDFA
LEDRGCWSSRAASRSPMNPRGRSRPPPAPSRVFSDCGHRLAEGRTRSEGPELGRAGLEPL
SLWFQDLGFGSGSRREECLPRSPFSPPLPSVCRETALKRFQNVFAQDHGTWDISAEKLAF
RGSVRAWERGRGEPGRAPVRERAQRSLTQGRGPAQGRPDTGTQLTFRGQSPFTSTNRERE
RDRGRQWMSRRGRGTGRLRKSISRVVDFYEESETDPGAEELPARIFVALFDYDPLTMSPN
PDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQLLR
QGFLPLNTPVEKIGGGSVGSWTHSAGRPPPPESSPRGMELPCVPTAARVLTAPSPHAGAT
RRVVALYDYDPRESSPNIDVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFL
E
Download sequence
Identical sequences M3XYB1
ENSMPUP00000004062 ENSMPUP00000004062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]