SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004844 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004844
Domain Number 1 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 472-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 191-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.97e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 10-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 528-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-18
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 7 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.56e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 8 Region: 322-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.6e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 9 Region: 153-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000133
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 98-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000249
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004844   Gene: ENSMPUG00000004884   Transcript: ENSMPUT00000004928
Sequence length 598
Comment pep:novel scaffold:MusPutFur1.0:GL896921.1:1873409:1887800:1 gene:ENSMPUG00000004884 transcript:ENSMPUT00000004928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQAVDLWDSQDSVAFEDVTVKFTMEEWALLDPSQKKLYRDVMQETFRNLASIVCGSEEK
WDIHDSEDQNENHGTDLSSQMVERLHKSKECSQYEEIFSQIPYHNQKKKSPTRIKLRKCT
LCGQVFMCHSSFNKHLRSHTGHKPYEYQECEEKPYKCKECGKSFKHRQSIRMHERTHTGQ
RPYECKHCGKAFICHNYFQIHERAHSGEKPYKCTKCGKTFSYSSNLRKHERTHIGEKPSD
CKQCGKAFRCLRSFRIHERIHSAKKPKECTKCGKTFRYSSNLRKHERSHNGEKPYECKES
GKAFHPLTKFRRDMIKQSGDGLYKCKECGKAFRCPKNCRSHEMTHSGVKPYECKECGKAF
SSPRSLGKHRRIHTSGKPHECKGCGKTFRYPSSLRNHERTHTGEKPYKCKECGKAFSCPN
YFRIPERTHTGVKPYECKQCGKAFSCAQSFRIHEKTHSAEKPYECTKCGKIFRYSSNLRK
HERSHTDDKRYECKLCGKAFSSHYYVQKHERTHTGEKPYECKECGKGFIFRSGVRSHMVI
HTGDGPYKCAKCKKAFISPTSLQTHERTHIGEKPYRCKICCKAFSLIHSLQNHERTHM
Download sequence
Identical sequences M3Y0J3
ENSMPUP00000004844 ENSMPUP00000004844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]