SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004930 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004930
Domain Number - Region: 110-134
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0822
Family Cyclophilin (peptidylprolyl isomerase) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004930   Gene: ENSMPUG00000004969   Transcript: ENSMPUT00000005014
Sequence length 393
Comment pep:novel scaffold:MusPutFur1.0:GL897048.1:3488403:3500064:1 gene:ENSMPUG00000004969 transcript:ENSMPUT00000005014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKPGSAEEAAQLPLRRTRAPVPALGPGPAAPDGSRASARLGLACMLLLLLLTLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDIHTCKAPKKAEWLDQT
Download sequence
Identical sequences M3Y0S9
XP_004769847.1.14098 ENSMPUP00000004930 ENSMPUP00000004930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]