SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004965 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004965
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.49e-81
Family BAR domain 0.0000000178
Further Details:      
 
Domain Number 2 Region: 301-365
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-22
Family SH3-domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004965   Gene: ENSMPUG00000005005   Transcript: ENSMPUT00000005050
Sequence length 368
Comment pep:novel scaffold:MusPutFur1.0:GL897062.1:1007521:1036456:-1 gene:ENSMPUG00000005005 transcript:ENSMPUT00000005050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDEDFKEMEKKVDVTSKAVTEVLARTIEYLQP
NPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGRIPD
EELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELADKL
KRRMRDASSRPKREYKPKPREPFDLGEPEQSNGGFPCATAPKITPSSSFRSSDKPIRTPS
RSMPPLDQPSCKALYDFEPENAGELGFHEGDVITLTNQIDENWYEGMLHGQSGFFPLSYV
EVLVPLPQ
Download sequence
Identical sequences M3Y0W4
XP_004771506.2.14098 ENSMPUP00000004965 ENSMPUP00000004965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]